Movie generated with PyMOL

A: d.9.1.1 (red/blue)

View d.9.1.1 in Scoppi
PDB: 1ml0 (Search literature with GoPubMed)
FA: Interleukin 8-like chemokines
SF: Interleukin 8-like chemokines
SP: Human (Homo sapiens)/Human (Homo sapiens)

B: b.116.1.1 (yellow)

View b.116.1.1 in Scoppi
PDB: 1ml0 (Search literature with GoPubMed)
FA: Viral chemokine binding protein m3
SF: Viral chemokine binding protein m3
SP: Murine herpesvirus 4, Muhv-4

C: d.9.1.1 (green)

View d.9.1.1 in Scoppi
PDB: 1b3a (Search literature with GoPubMed)
FA: Interleukin 8-like chemokines
SF: Interleukin 8-like chemokines
SP: Human (Homo sapiens)

com Center of mass, domain d.9.1.1
com Center of mass, domain b.116.1.1
com Center of mass of interface atoms, domain b.116.1.1
com Center of mass, domain d.9.1.1
com Center of mass of interface atoms, domain d.9.1.1

Geometric Parameters

RMSD A1-A2 0.79
Shared interface atoms 212 (70.0%)
Angle between green and yellow interface: 32.37
Angle between green and yellow domain: 60.06
Distance between center of mass of green and yellow interface (in Angstrom): 9.36
Distance between center of mass of green and yellow domain (in Angstrom) 36.54

Sequence Alignment of domain d.9.1.1



-----aVTCCYNFTnrkisvqrlasyrritssKcPKeavIfktivakEICadpkqkwvqdsidhldkqt
PYSSDTTPCCFAYIarplprahikeyfy-tsgKCSnpavVfvtrknrQVCanpekkwvreyinslems-
     _..##:.:.                  #_._   :       ::#                    



Aligned interface residues
. : #
14 (66%)
Aligned, similar interface residues (with positive BLOSUM value)
: #
9 (42%)
Raw BLOSUM-Score for the latter residues 46

Meaning
   
Capital letters
Residue interacts with domain A
#
Identical interacting residues
:
Residues are similar and interact
.
Residues are not similar and interact
_
Only one residue interacts
   

Sequences of domain b.116.1.1 and d.9.1.1



hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknkmgvpwvsveelgqeiitgrl 
pfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelqtelytfglsddnvvftsdymtvwmidipksyvdvgmltra 
tfleqwpgakvtvmipysstftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg 
gppqqakmntcpcYYKYSVSPLPAMdhliladlagldsltspvyvmaayfdsthenpvrpssklyhcalqmtshdgvwts 
tsseqcpirlvegqsqnvlqvrvaPTsmPnlvgvslmlegqqyrleyfgdh 


pYSSDTTPCCFAYIarplprahikeyfyTsgKCSnpavVfvtrknrQVCanpekkwvreyinslems 

Similarities between domain b.116.1.1 and d.9.1.1

Residue PairAtom MatchesBLOSUMScoreAvg.-Distance
Ser269-Ser4 ca cb bb bb bb sc sc sc 4 9.46 0.95
Tyr268-Tyr3 ca bb bb bb sc 7 8.83 1.90
Pro274-Pro9 ca bb bb bb 7 8.25 2.06
Tyr266-Tyr3 sc 7 7.77 0.70
Pro272-Thr7 ca cb bb bb bb sc sc sc -1 7.01 0.37
Ser271-Asp6 ca cb bb bb bb sc sc sc 0 6.39 0.60
Val270-Ser5 ca cb bb bb bb sc sc sc -2 6.07 0.72
Leu273-Thr8 ca cb bb bb bb sc sc sc -1 4.89 1.17
Ala275-Cys10 ca cb sc 0 1.97 1.03
Pro356-Lys33 ca cb bb sc -1 1.20 2.10
Met276-Thr30 sc sc -1 1.13 1.31
Met276-Cys34 bb bb sc -1 1.07 1.93
Lys267-Tyr3 bb bb -2 0.92 1.62
Pro360-Tyr3 sc sc -3 0.74 1.89
Ala275-Pro9 bb bb bb -1 0.77 2.23
Tyr266-Lys33 sc -2 0.58 1.25
Leu273-Lys33 sc -2 0.45 1.66
Ala275-Thr30 sc 0 0.34 1.99
Thr357-Lys33 bb -1 0.01 2.97
Tyr265-Ser4 bb -2 0.03 2.92
Total Score 67.87

SymbolAtom match between
ca C-alpha atoms within 3 A
cb C-beta atoms within 3 A
bb backbone atoms within 3 A
sc side chain atoms within 2 A

The score for each residue pair is simply its BLOSUM score (if positive) + the sum of atom pair scores.
The latter are between 0 and 1, with 0 for 3A distance or above
and 1 for exact coordinate matches, linearly interpolated.