![]() Movie generated with PyMOL |
| |||||||||||||
![]() | ![]() |
| RMSD A1-A2 | 0.79 |
| Shared interface atoms | 212 (70.0%) |
| Angle between green and yellow interface: | 32.37 |
| Angle between green and yellow domain: | 60.06 |
| Distance between center of mass of green and yellow interface (in Angstrom): | 9.36 |
| Distance between center of mass of green and yellow domain (in Angstrom) | 36.54 |
-----aVTCCYNFTnrkisvqrlasyrritssKcPKeavIfktivakEICadpkqkwvqdsidhldkqt PYSSDTTPCCFAYIarplprahikeyfy-tsgKCSnpavVfvtrknrQVCanpekkwvreyinslems- _..##:.:. #_._ : ::# | |
Aligned interface residues . : # | 14 (66%) |
Aligned, similar interface residues (with positive BLOSUM value) : # | 9 (42%) |
| Raw BLOSUM-Score for the latter residues | 46 |
| Meaning | |
|---|---|
Capital letters |
Residue interacts with domain A |
# |
Identical interacting residues |
: |
Residues are similar and interact |
. |
Residues are not similar and interact |
_ |
Only one residue interacts |
hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknkmgvpwvsveelgqeiitgrl pfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelqtelytfglsddnvvftsdymtvwmidipksyvdvgmltra tfleqwpgakvtvmipysstftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg gppqqakmntcpcYYKYSVSPLPAMdhliladlagldsltspvyvmaayfdsthenpvrpssklyhcalqmtshdgvwts tsseqcpirlvegqsqnvlqvrvaPTsmPnlvgvslmlegqqyrleyfgdh pYSSDTTPCCFAYIarplprahikeyfyTsgKCSnpavVfvtrknrQVCanpekkwvreyinslems |
| Residue Pair | Atom Matches | BLOSUM | Score | Avg.-Distance |
|---|---|---|---|---|
| Ser269-Ser4 |
![]() |
4 | 9.46 | 0.95 |
| Tyr268-Tyr3 |
![]() |
7 | 8.83 | 1.90 |
| Pro274-Pro9 |
![]() |
7 | 8.25 | 2.06 |
| Tyr266-Tyr3 | ![]() |
7 | 7.77 | 0.70 |
| Pro272-Thr7 |
![]() |
-1 | 7.01 | 0.37 |
| Ser271-Asp6 |
![]() |
0 | 6.39 | 0.60 |
| Val270-Ser5 |
![]() |
-2 | 6.07 | 0.72 |
| Leu273-Thr8 |
![]() |
-1 | 4.89 | 1.17 |
| Ala275-Cys10 |
![]() |
0 | 1.97 | 1.03 |
| Pro356-Lys33 |
![]() |
-1 | 1.20 | 2.10 |
| Met276-Thr30 |
![]() |
-1 | 1.13 | 1.31 |
| Met276-Cys34 |
![]() |
-1 | 1.07 | 1.93 |
| Lys267-Tyr3 |
![]() |
-2 | 0.92 | 1.62 |
| Pro360-Tyr3 |
![]() |
-3 | 0.74 | 1.89 |
| Ala275-Pro9 |
![]() |
-1 | 0.77 | 2.23 |
| Tyr266-Lys33 | ![]() |
-2 | 0.58 | 1.25 |
| Leu273-Lys33 | ![]() |
-2 | 0.45 | 1.66 |
| Ala275-Thr30 | ![]() |
0 | 0.34 | 1.99 |
| Thr357-Lys33 | ![]() |
-1 | 0.01 | 2.97 |
| Tyr265-Ser4 | ![]() |
-2 | 0.03 | 2.92 |
| Total Score | 67.87 | |||
| | ||||
| Symbol | Atom match between | |||
![]() | C-alpha atoms within 3 A | |||
![]() | C-beta atoms within 3 A | |||
![]() | backbone atoms within 3 A | |||
![]() | side chain atoms within 2 A | |||
|
The score for each residue pair is simply its BLOSUM score (if positive) + the sum of atom pair scores. The latter are between 0 and 1, with 0 for 3A distance or above and 1 for exact coordinate matches, linearly interpolated. | ||||