![]() Movie generated with PyMOL |
| |||||||||||||
![]() | ![]() |
| RMSD A1-A2 | 1.24 |
| Shared interface atoms | 510 (63.6%) |
| Angle between green and yellow interface: | 23.67 |
| Angle between green and yellow domain: | 20.61 |
| Distance between center of mass of green and yellow interface (in Angstrom): | 9.24 |
| Distance between center of mass of green and yellow domain (in Angstrom) | 10.46 |
mteyklvvvgAGGvgkSaltIqliQnhfvDEYDPTIEDSY-RkqvvidgetclldildtaGQEEYsAMrdqymrtgegfl qvqfklvlvgDGGtgkttfvkrhltgefekKYVATLGVEvhplvfhtnrgpikfnvwdtAGQEKfggLRdgYyiqaqcai .## _ _ _ _:#..#:..._ _ _###:_ _:_ _ cvfainNtKsfeDihqyreqikrvkdsddvpmvlvgnKcdlaartvesrqaqdlarsyg-ipyietsakt---------- imfDvTSRVTyKNvpnw--hrdlvrvcenipivlcgnKvd--iKDRKvKaksivfhrkknlqyydisaksnynfekpflw _ _:_._ _: # ____ _ -------rqgve-----------dafytlvreirqh-------------- larkligdpnlefvampalappevvmdpalaaqyehdlevaqttalpded | |
Aligned interface residues . : # | 21 (61%) |
Aligned, similar interface residues (with positive BLOSUM value) : # | 14 (41%) |
| Raw BLOSUM-Score for the latter residues | 53 |
| Meaning | |
|---|---|
Capital letters |
Residue interacts with domain A |
# |
Identical interacting residues |
: |
Residues are similar and interact |
. |
Residues are not similar and interact |
_ |
Only one residue interacts |
mpeeeysefkelilqkelhvvyalshvcgqdRTllasillriflhekleslllctlndreismedeATTLFRATTlaSTl mEqymKatatqfvhhalkdsilkimeskqscelspSkleknedvntnlthllnilselvekifmaseilpptlryiygcl qksvqhkwptnttmrtRvvsGfvFLRliCPaiLNprmfniisdspspiaaRtlIlvAKsvQNlaNlVefgAKEpYmegvn pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnergaqqhvlkkllaitellqqkq arfsiegkSLkldaittedeksvfavlleddsvkeivlsGNTigteaarwlseniaskkdleiaefsDiFTGRVKdeIPe alrlllqallkcpklhtvrlsDNAFGPTaqeplidflskhtplehlylhNNGLGPQagakiaralqelavnkkaknappl rsiicgRNRlengsmkewaktfqshrllhtvkmVQngiRpegiehllleglaycqelkvldlQDNTfThlgssalaialk swpnlrelglnDCLlsargaaavvdafskleniglqtlrlqYneieldavrtlktvidekmpdllflelngnrfseeddv vdeirevfstrgrgeldelddmEe |
| Residue Pair | Atom Matches | BLOSUM | Score | Avg.-Distance |
|---|---|---|---|---|
| Lys935-Lys76 |
![]() |
5 | 6.87 | 1.59 |
| Phe901-Phe106 | ![]() |
6 | 6.44 | 1.69 |
| Arg789-Arg168 |
![]() |
5 | 5.79 | 1.81 |
| Asn911-Thr43 |
![]() |
0 | 5.09 | 1.30 |
| Phe788-Asn169 |
![]() |
-3 | 4.05 | 1.26 |
| Ile931-Val75 |
![]() |
3 | 3.99 | 1.52 |
| Thr786-Arg170 |
![]() |
-1 | 3.84 | 1.56 |
| Arg894-Gln137 |
![]() |
1 | 3.34 | 1.60 |
| Glu799-Asp103 |
![]() |
2 | 3.24 | 1.15 |
| Pro907-Phe71 |
![]() |
-4 | 2.50 | 1.75 |
| Arg903-Asn131 |
![]() |
0 | 2.26 | 1.30 |
| Cys906-Ile79 |
![]() |
-1 | 1.92 | 1.56 |
| Arg903-Asn132 |
![]() |
0 | 1.66 | 1.34 |
| Thr791-Arg168 |
![]() |
-1 | 1.74 | 1.26 |
| Leu787-Asn169 |
![]() |
-3 | 1.80 | 1.20 |
| Leu902-Phe106 |
![]() |
0 | 1.38 | 1.97 |
| Arg903-Asn104 |
![]() |
0 | 1.46 | 1.90 |
| Gln938-Lys76 |
![]() |
1 | 1.18 | 2.73 |
| Ala784-Arg170 |
![]() |
-1 | 1.23 | 1.77 |
| Ser795-Asn131 | ![]() |
1 | 1.04 | 2.88 |
| Ala934-Lys76 |
![]() |
-1 | 1.11 | 1.89 |
| Gln938-Thr109 |
![]() |
-1 | 1.02 | 1.47 |
| Leu787-Arg170 |
![]() |
-2 | 0.88 | 1.69 |
| Leu902-Ala105 |
![]() |
-1 | 0.83 | 1.75 |
| Ala934-Val75 |
![]() |
0 | 0.90 | 1.65 |
| Asn942-Thr109 |
![]() |
0 | 0.98 | 1.52 |
| Ala790-Arg168 |
![]() |
-1 | 1.00 | 2.25 |
| Ala784-Pro136 |
![]() |
-1 | 0.89 | 1.66 |
| Gln938-Phe106 | ![]() |
-3 | 0.56 | 1.31 |
| Gly898-Asn132 |
![]() |
0 | 0.48 | 2.28 |
| Asn942-Pro108 |
![]() |
-2 | 0.45 | 2.33 |
| Leu902-Asn132 | ![]() |
-3 | 0.52 | 1.43 |
| Phe788-Arg168 | ![]() |
-3 | 0.39 | 1.83 |
| Cys906-Arg74 | ![]() |
-3 | 0.40 | 1.79 |
| Leu910-Gly73 | ![]() |
-4 | 0.42 | 1.74 |
| Phe788-Asn132 | ![]() |
-3 | 0.26 | 2.22 |
| Leu910-Arg74 |
![]() |
-2 | 0.32 | 2.51 |
| Total Score | 72.24 | |||
| | ||||
| Symbol | Atom match between | |||
![]() | C-alpha atoms within 3 A | |||
![]() | C-beta atoms within 3 A | |||
![]() | backbone atoms within 3 A | |||
![]() | side chain atoms within 2 A | |||
|
The score for each residue pair is simply its BLOSUM score (if positive) + the sum of atom pair scores. The latter are between 0 and 1, with 0 for 3A distance or above and 1 for exact coordinate matches, linearly interpolated. | ||||