 Movie generated with PyMOL |
| |||||||||||||
 |  |
A: c.37.1.8 (red/blue) 
B: a.116.1.2 (yellow) 
C: a.24.11.1 (green) 
Geometric Parameters
| RMSD A1-A2 | 1.20 |
| Shared interface atoms | 454 (85.7%) |
| Angle between green and yellow interface: | 5.44 |
| Angle between green and yellow domain: | 22.49 |
| Distance between center of mass of green and yellow interface (in Angstrom): | 1.74 |
| Distance between center of mass of green and yellow domain (in Angstrom) | 9.61 |
Sequence Alignment of domain c.37.1.8
mteyklvvvgAGGvgkSaltIqliQnhfvDEYDPTIEDSYRkqvvidgetclldildtaGQEEYsAMrdqymrtgegflc pqaikcvvvgdGAvgktcllisyttnafpgEYIPTVFDNysanvmvdgkpvnlglWdtagQEDYdRLrpLsypqtdvfli _#. _ _ _ _##.##:.#:__ _ _##:# .: _ vfainNtKsfeDihqyreqikrvkdsddvpmvlvgnKcd-------------laartvesrqaqdlarsyg-ipyietsa cfslvspasfenvra-kwypevrhhcpntpiilvgtKldlrddkdtieKlkeKkltpitypqglamakeigavkylecsa _ _ _ # _ ktrqgvedafytlvreirqh ltqrglktvfdeairav--- | |
Aligned interface residues . : # | 18 (62%) |
Aligned, similar interface residues (with positive BLOSUM value) : # | 14 (48%) |
| Raw BLOSUM-Score for the latter residues | 66 |
| Meaning | |
|---|---|
Capital letters |
Residue interacts with domain A |
# |
Identical interacting residues |
: |
Residues are similar and interact |
. |
Residues are not similar and interact |
_ |
Only one residue interacts |
Sequences of domain a.116.1.2 and a.24.11.1
mpeeeysefkelilqkelhvvyalshvcgqdRTllasillriflhekleslllctlndreismedeATTLFRATTlaSTl mEqymKatatqfvhhalkdsilkimeskqscelspSkleknedvntnlthllnilselvekifmaseilpptlryiygcl qksvqhkwptnttmrtRvvsGfvFLRliCPaiLNprmfniisdspspiaaRtlIlvAKsvQNlaNlVefgAKEpYmegvn pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnergaqqhvlkkllaitellqqkq assAvvFKqmVLqQAlPMTlKGldKaselatltpeglaRehSrlASGDgalRSlSTAlAGiragsqveesriqagrller siggialQQwGTTggaasqlvLdaspelrreitdqlhqvmsevallrqavesevs |
Similarities between domain a.116.1.2 and a.24.11.1
| Residue Pair | Atom Matches | BLOSUM | Score | Avg.-Distance |
|---|---|---|---|---|
| Arg789-Arg146 | 
|
5 | 8.87 | 1.06 |
| Thr785-Thr186 | 
|
5 | 8.29 | 1.59 |
| Thr786-Thr187 |
|
5 | 7.67 | 1.40 |
| Lys803-Lys115 |
|
5 | 7.09 | 1.43 |
| Lys935-Lys102 | |
5 | 5.57 | 1.29 |
| Thr785-Thr187 | |
5 | 5.48 | 1.55 |
| Thr786-Thr186 | |
5 | 5.06 | 2.83 |
| Ala934-Ala153 |
|
4 | 4.76 | 1.87 |
| Ile931-Val105 |
|
3 | 4.34 | 1.66 |
| Ile931-Leu106 |
|
2 | 3.60 | 1.40 |
| Gln938-Ala153 |
|
-1 | 3.51 | 1.50 |
| Arg894-Gln183 |
|
1 | 3.34 | 1.24 |
| Arg928-Lys102 |
|
2 | 2.98 | 1.53 |
| Leu910-Ala109 |
|
-1 | 2.92 | 1.54 |
| Leu787-Ala139 |
|
-1 | 2.79 | 1.61 |
| Leu902-Thr150 |
|
-1 | 2.31 | 1.27 |
| Arg903-Ser147 |
|
-1 | 2.11 | 1.73 |
| Glu799-Lys119 |
|
1 | 2.06 | 1.40 |
| Gly898-Ser147 |
|
0 | 1.95 | 1.05 |
| Thr786-Ala139 |
|
0 | 2.03 | 0.97 |
| Arg789-Gly141 |
|
-2 | 1.85 | 1.15 |
| Leu910-Gln108 |
|
-2 | 1.74 | 1.26 |
| Arg903-Gly116 |
|
-2 | 1.83 | 1.17 |
| Pro907-Ala109 |
|
-1 | 1.44 | 1.56 |
| Phe901-Ala151 |
|
-2 | 1.51 | 1.87 |
| Ala784-Thr186 |
|
0 | 1.59 | 1.41 |
| Ala790-Gly141 |
|
0 | 1.56 | 0.66 |
| Cys906-Ala109 |
|
0 | 1.27 | 1.73 |
| Leu910-Val105 | |
1 | 1.36 | 1.92 |
| Leu902-Ala151 |
|
-1 | 1.31 | 2.02 |
| Glu950-Lys102 | |
1 | 1.34 | 1.97 |
| Asn942-Gln182 |
|
0 | 1.20 | 1.80 |
| Ser795-Asp142 |
|
0 | 1.06 | 1.41 |
| Pro907-Met112 |
|
-2 | 1.09 | 1.91 |
| Ile931-Lys102 |
|
-3 | 1.05 | 1.95 |
| Arg903-Asp142 |
|
-2 | 0.82 | 1.77 |
| Asn911-Gln108 |
|
0 | 0.87 | 1.69 |
| Arg928-Ala98 |
|
-1 | 0.88 | 1.68 |
| Ala790-Asp142 |
|
-2 | 0.91 | 1.64 |
| Gln938-Thr150 | |
-1 | 0.51 | 1.47 |
| Gln938-Ser149 | |
0 | 0.61 | 1.18 |
| Asn911-Met112 | |
-2 | 0.40 | 1.81 |
| Pro907-Thr113 | |
-1 | 0.41 | 1.77 |
| Gly898-Ser149 |
|
0 | 0.49 | 2.27 |
| Val944-Gln182 | |
-2 | 0.44 | 1.67 |
| Ser795-Lys119 | |
0 | 0.46 | 1.61 |
| Arg789-Ser140 |
|
-1 | 0.34 | 2.49 |
| Cys906-Thr113 | |
-1 | 0.42 | 1.75 |
| Phe788-Ala139 | |
-2 | 0.47 | 1.58 |
| Ala934-Gly154 |
|
0 | 0.28 | 2.58 |
| Phe788-Ser140 | |
-2 | 0.22 | 2.35 |
| Phe788-Asp142 | |
-3 | 0.11 | 2.66 |
| Thr791-Asp142 | |
-1 | 0.01 | 2.98 |
| Lys935-Ala153 | |
-1 | 0.07 | 2.78 |
| Arg928-Phe101 | |
-3 | 0.01 | 2.96 |
| Total Score | 116.66 | |||
| | ||||
| Symbol | Atom match between | |||
| C-alpha atoms within 3 A | |||
| C-beta atoms within 3 A | |||
| backbone atoms within 3 A | |||
| side chain atoms within 2 A | |||
|
The score for each residue pair is simply its BLOSUM score (if positive) + the sum of atom pair scores. The latter are between 0 and 1, with 0 for 3A distance or above and 1 for exact coordinate matches, linearly interpolated. | ||||
