 Movie generated with PyMOL |
| |||||||||||||
 |  |
A: a.39.1.5 (red/blue) 
B: a.39.1.5 (yellow) 
C: e.41.1.1 (green) 
Geometric Parameters
| RMSD A1-A2 | 0.90 |
| Shared interface atoms | 405 (53.5%) |
| Angle between green and yellow interface: | 71.35 |
| Angle between green and yellow domain: | 63.67 |
| Distance between center of mass of green and yellow interface (in Angstrom): | 15.88 |
| Distance between center of mass of green and yellow domain (in Angstrom) | 24.40 |
Sequence Alignment of domain a.39.1.5
------------se-----------eEi---------------------------------------------------- tEEQiAEfkEAfSLFdKdgdgtittkelgTVmrSLGqnpteaelqdminevdadgngtidfpefltmmarkmkdtdseEE __ _ -rEAfRVFdKdgngyisaaelrhVMtNLGEKLtdeEvdEMireadidgdgqvnyeeFvqMM-- IREAFRVFDKdGNGYisaaeLrHVMtNLGEkLtdeEvdEMiREADIDGDGqvNYEEFvQMMTA _##_###_# ____ _ _## ####_# # ## _________ ____# _## | |
Aligned interface residues . : # | 19 (30%) |
Aligned, similar interface residues (with positive BLOSUM value) : # | 19 (30%) |
| Raw BLOSUM-Score for the latter residues | 94 |
| Meaning | |
|---|---|
Capital letters |
Residue interacts with domain A |
# |
Identical interacting residues |
: |
Residues are similar and interact |
. |
Residues are not similar and interact |
_ |
Only one residue interacts |
Sequences of domain a.39.1.5 and e.41.1.1
seeEirEAfRVFdKdgngyisaaelrhVMtNLGEKLtdeEvdEMireadidgdgqvnyeeFvqMM ridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnvhgkssdwgpvagyipfdqdls kkhgqqlavekgnlenkksitehegeigkiplkldhlrieelkengiilkgkkeidngkkyyllesnnqvyefrisdenn evqyktkegkitvlgekfnwrnievmaknvegvlkpltadydlfalapsLTeIKkqIpqkeWdkvVntpnSLeKQKgVTN lLIkygIERkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekdneifiinpegefiltknwemt grfiEkniTGKDYLYYFnRsynkiapgnkayiewtDPItKAkiNTIpTSAEfIKnLSSiRRssnvgvYKdsgdkdefakk esvKkiagylsdYYNSaNHifsQekKRkiSifrgiqayneienvlkskqiapeyknyfqylkeritnQvqLLltHqkfkl lykqlnftenetdnfevfqkiid |
Similarities between domain a.39.1.5 and e.41.1.1
| Residue Pair | Atom Matches | BLOSUM | Score | Avg.-Distance |
|---|---|---|---|---|
| Arg90-Arg540 | 
|
5 | 6.61 | 1.39 |
| Val108-Val529 | 
|
4 | 6.40 | 1.80 |
| Asn111-Asn531 | |
6 | 6.48 | 1.57 |
| Val91-Ile538 | 
|
3 | 5.16 | 1.38 |
| Val91-Ile534 |
|
3 | 4.93 | 1.55 |
| Met109-Val529 |
|
1 | 4.37 | 1.56 |
| Phe141-Ile504 |
|
0 | 3.94 | 1.69 |
| Glu114-Lys525 |
|
1 | 3.83 | 1.79 |
| Asn111-Lys527 |
|
0 | 3.79 | 1.74 |
| Met145-Leu501 |
|
2 | 3.36 | 0.96 |
| Glu87-Tyr626 |
|
-2 | 2.92 | 1.54 |
| Leu116-Val517 |
|
1 | 2.78 | 2.11 |
| Met124-Trp513 |
|
-1 | 2.44 | 1.17 |
| Gly113-Ser522 |
|
0 | 2.32 | 1.26 |
| Phe92-Leu533 |
|
0 | 2.31 | 1.61 |
| Met109-Lys525 |
|
-1 | 2.10 | 0.90 |
| Glu84-Leu625 |
|
-3 | 2.14 | 1.40 |
| Arg90-Ile538 |
|
-3 | 1.86 | 1.60 |
| Leu112-Gln526 |
|
-2 | 1.91 | 1.86 |
| Met144-Thr502 |
|
-1 | 1.78 | 2.24 |
| Lys94-Glu539 | |
1 | 1.55 | 1.36 |
| Met144-Lys505 |
|
-1 | 0.98 | 1.53 |
| Arg90-Glu539 |
|
0 | 0.88 | 1.68 |
| Leu112-Lys527 |
|
-2 | 0.95 | 1.57 |
| Glu120-Val517 |
|
-2 | 0.74 | 1.88 |
| Arg90-Ile534 | |
-3 | 0.45 | 1.64 |
| Val108-Gln526 | |
-2 | 0.35 | 1.94 |
| Leu112-Thr530 | |
-1 | 0.43 | 1.72 |
| Lys115-Val517 |
|
-2 | 0.37 | 2.44 |
| Glu114-Ser522 | |
0 | 0.46 | 1.63 |
| Phe141-Thr502 | |
-2 | 0.28 | 2.15 |
| Ala88-Leu533 | |
-1 | 0.17 | 2.50 |
| Gly113-Leu523 | |
-4 | 0.24 | 2.29 |
| Ala88-Leu625 | |
-1 | 0.26 | 2.22 |
| Glu84-Tyr626 |
|
-2 | 0.32 | 2.52 |
| Met145-Thr502 | |
-1 | 0.05 | 2.84 |
| Glu87-Ile538 |
|
-3 | 0.01 | 2.99 |
| Total Score | 79.90 | |||
| | ||||
| Symbol | Atom match between | |||
| C-alpha atoms within 3 A | |||
| C-beta atoms within 3 A | |||
| backbone atoms within 3 A | |||
| side chain atoms within 2 A | |||
|
The score for each residue pair is simply its BLOSUM score (if positive) + the sum of atom pair scores. The latter are between 0 and 1, with 0 for 3A distance or above and 1 for exact coordinate matches, linearly interpolated. | ||||
